We fetch to your attention a new website where you can buy priligy australia at a low price with fast delivery to Australia.

Xn--oikeusministeri-ntb.fi

SAMMANFATTNING

Kommitténs uppdrag, sammansättning och arbete

Statsrådet tillsatte den 20 juni 2001 en kommitté vars uppgift var att utarbeta en utredning
om riktlinjerna för utvecklingen av domstolsväsendet. Med detta avses en vision för
utvecklingen av domstolsväsendet på lång sikt. Syftet med utredningen är att förutse vilka
krav samhället ställer på domstolarna i framtiden och på vilket sätt domstolarna borde
förbereda sig på dessa krav. Tonvikten i arbetet skulle ligga på analys av rättskyddsfrågor
och framtidsanalys samt på bedömning av samhällsvärderingar och utvecklingstrender.
Syftet är att visionen kan utnyttjas vid fastställandet av konkreta utvecklingsobjekt.
Utredningen skulle omfatta den framtida utvecklingen inom drygt 10 år, eventuellt t.o.m.
15-20 år. Utgångspunkten för kommitténs arbete är de grundläggande principerna för
rättskipning enligt grundlagen och grundrättighetsperspektivet.
Kommittén bestod under hela sin mandatperiod av tretton medlemmar och tre permanenta
sakkunniga. Kommittén har haft två heltidsanställda sekreterare.
Kommitténs mandatperiod började den 1 augusti 2001 och löpte ut den 30 november
2003. Kommittén sammanträdde i regel var tredje vecka. Kommittén höll sammanlagt 33
sammanträden av vilka fyra var två dagar långa. Kommittén var dessutom indelad i sex
styrningsgrupper och varje grupp hade ett eget tema. Under sitt arbete ordnade kommittén
seminarier, hörde sakkunniga och gjorde två besöksresor. Kommittén överlämnade ett
mellanbetänkande om sitt arbete i januari 2003. I juni 2003 ordnade kommittén ett
omfattande informationsmöte.
Bakgrundsinformation om domstolsväsendet i Finland

Enligt Finlands grundlag är rättskydd en grundläggande rättighet, dvs. var och en har rätt
att på behörigt sätt och utan ogrundat dröjsmål få sin sak behandlad av en domstol. I
grundlagen ingår dessutom bestämmelser om domstolarnas oberoende och den
grundläggande strukturen av domstolsorganisationen.
Domstolsväsendet består av allmänna domstolar och allmänna förvaltningsdomstolar.
Dessutom finns det vissa specialdomstolar. Allmänna domstolar är högsta domstolen,
hovrätterna och tingsrätterna. Dessa handlägger tviste- och brottmål. Tingsrätterna
behandlar också ett stort antal ansökningsärenden. Allmänna förvaltningsdomstolar är
högsta förvaltningsdomstolen och de regionala förvaltningsdomstolarna.
Förvaltningsdomstolarna behandlar besvär över myndigheters beslut, t.ex. i miljö-, social-
eller skattefrågor. Till specialdomstolarna hör marknadsdomstolen, arbetsdomstolen och
försäkringsdomstolen. De handlägger ärenden som hör till deras specialområde.
Ändringar i domstolarnas verksamhetsmiljö samt utgångspunkterna för
verksamheten: utmaningar för domstolsväsendet (I-IV)
Kommittén har i sitt arbetet strävat till att sammanföra både de externa (samhället och
användarna av domstolarnas tjänster) och interna (domstolsväsendets organisation och
personal) aspekterna i domstolsväsendets verksamhet. Av denna anledning var det nödvändigt att först betrakta ändringarna i domstolarnas verksamhetsmiljö. Kommittén har i betänkandets kapitel II behandlat ändringar i samhället ur följande utgångspunkter: strukturen av Finlands befolkning och näringsliv, välfärdssamhället, samhällets differentiering, den offentliga förvaltningen, den demokratiska rättsstaten, informationssamhället, globaliseringen, Europas integration, juridikens verkan i samhället och ändringarna i rättsordningen. I betänkandets kapitel III har kommittén behandlat allmänna och rättsliga utgångspunkter för domstolarnas verksamhet. Kommittén har först betraktat domstolarnas ställning i samhället och lagskipningsverksamhetens uppgifter. Denna fråga har behandlats både ur en rättslig och en sociologisk synvinkel. Kommittén har också behandlat grundlagen, konventionerna om de mänskliga rättigheterna och EG-rätten som grundläggande rättsliga utgångspunkter för domstolsväsendets verksamhet. Kommittén har skilt behandlat innebörden av domstolarnas oberoende. Ytterligare har kommittén behandlat rättsskyddssystemet som tillämpas inom förvaltningen. När domstolsväsendet betraktas ur en extern synvinkel är utöver samhället också användarna av domstolarnas tjänster en viktig grupp. Kommittén har behandlat tillgången till rättstjänster ur denna synvinkel. Tillgången till rättstjänster är ett genomgående tema för hela betänkandet och kommittén har i flera av sina ställningstaganden framhävt vikten av att främja denna. Kommittén har konstaterat att när tillgången till rättstjänster förbättras skall tillräckligt hänsyn tas till kundens synvinkel. För att rättsystemet skall fungera och för att förtroendet för dess verksamhet skall öka är det nödvändigt att rättigheterna som garanteras av rättsordningen också i praktiken kan tillgodoses. För detta syfte har kommittén efter tillgången till rättstjänster utrett allmänhetens förtroende för domstolarna. Som en syntes av kapitel III har kommittén lagt fram en presenterat en rättegång ur två synvinklar. I rättsstatstänkandet är rättegångsförfarandets slutresultat, dvs. domen, i centrum. På detta sätt kan det sägas att domstolarnas centrala uppgift är att trygga rättsskyddet genom att tillämpa lagen på enskilda fall. Å andra sidan skall också förfarandet vara rättvist. Vid utvecklingsarbetet är det viktigt att fästa uppmärksamhet vid att kunderna upplever att förfarandet är rättvist. De som använder domstolarnas tjänster är alltid aktiva deltagare och aldrig opersonliga föremål för domstolens verksamhet. Domstolarnas verksamhet och rättegångprocessen skall således utvecklas utgående från att den som använder domstolens tjänster vill följa behandlingen av sitt ärende och delta och påverka i behandlingen. De som deltar i rättegångarna skall kunna uppleva att processen baserar sig på öppen diskussion och att den är rättvis. Processen skall dessutom öka deltagarens förtroende för domstolarnas verksamhet. Domstolsväsendet har ändrats drastiskt sedan 1970-talet. Genom totalreformen som pågått ända fram till de senaste åren har domstolarnas verksamhet anpassats till dagens minimikrav. Kommittén har således kunnat koncentrera sig på att diskutera på vilket sätt det i sig fungerande domstolsväsendet kan bli ännu bättre och hur det kan tryggas att domstolarnas utveckling inte stannar upp eller släpar efter i det ständigt föränderliga samhället. Medborgarnas förväntningar ändras och anspråksnivå ökar, vilket innebär att det som idag är en tillräcklig nivå för domstolstjänster är kanske inte det i morgon. Vilka ärenden borde domstolarna behandla (V)

Kommittén har tagit fram allmänna motiveringar för vilka ärenden som borde styras till
domstolarna. Arbetet har syftat till att definiera domstolarnas uppgifter och samhälleliga
roll. Domstolarna är en central del av den rättsliga problemlösningen i det moderna
samhället. En stor del av tvisterna löses dock utanför domstolarna vid olika officiella,
halvofficiella eller privata konfliktlösningsorgan. Det finns dessutom olika samhälleliga
mekanismer som syftar till att förebygga och hindra konflikter.
I kapitlets första del redogörs det för de rättsliga och andra grunder som skall tas i
beaktande när domstolarnas uppgifter och roll definieras. För det första behandlas frågan
ur statsförfattningsrättslig synvinkel. Grundlagen ger en översikt över domstolens
samhälleliga uppgifter ur lagstiftarens synvinkel. För det andra behandlas temat utgående
från de grundläggande och mänskliga rättigheterna. Domstolarnas uppgifter och roll i
samhället kan inte behandlas enbart som en ändamålsenlighetsfråga, eftersom de
grundläggande och mänskliga rättigheterna förutsätter att tillgången till domstolar och
rättsskydd tryggas i vissa ärenden. Det finns klara och bestående kriterier för detta i
bestämmelserna om grundläggande och mänskliga rättigheter. I samband med detta
behandlas även den internationella lagstiftningen som är bindande för Finland, i synnerhet
kraven som ställs inom EG-rätten. För det tredje behandlas domstolarnas uppgifter och
roll utgående från den s.k. mervärdesdebatten. Då är frågeställningen: Varför borde
ärendet behandlas just av domstolen? Vilket särskilt mervärde ger domstolsbehandlingen
jämfört med andra myndigheter eller organ? Frågorna besvaras utgående från
domstolarnas resurser och uppgiftsbeskrivning. Efter detta presenteras de
bedömningskriterier som utgör grunden för kommitténs analys.
Kommitténs ställningstaganden

1) Överförande av beslutanderätten till polisen och åklagaren. I fråga om beslutanderätt i
brottmål framhäver kommittén betydelsen av parternas och i synnerhet den
misstänktas/åtalades rättsskydd. Kommittén anser att man bör förhålla sig återhållsamt till
att polisen eller åklagaren skulle ges mer omfattande beslutanderätt i brottmål än för
närvarande. Denna fråga är problematisk både principiellt och med tanke på rättskyddet
och de grundläggande och mänskliga rättigheterna. De ökade kraven på brottsprocessen
kan beaktas genom att utveckla rättegångsförfarandet i en enklare och smidigare riktning.
Samarbetet mellan polisen och åklagaren bör intensifieras. Det vore en positiv utveckling
om åklagarna kunde sköta vissa uppgifter som nu hör till undersökningsledarna.
Dessutom bör även förfarandet angående slutliga utlåtanden utvecklas.
2) Tillgången till rättsskydd i förvaltningsrättskipningsärenden. Det klaraste sättet att
trygga tillgången till rättsskydd i förvaltningsärenden är förvaltningsbeslut. Kommittén
har fäst uppmärksamhet vid eventuella skuggområden i fråga om rättsskydd. När privata
aktörer sköter offentligrättsliga uppgifter skall rättskyddet för centrala delar garanteras på
samma sätt som när uppgiften sköts av en myndighet. För närvarande skall det stadgas
särskilt om anförande av besvär över ett sådant förvaltningsbeslut som en privat aktör har
fattat med stöd av till den överförda befogenheter. Kommittén anser att besvärsrätten skall
utvidgas till att regelmässigt omfatta dylika förvaltningsbeslut. Ett annat eventuellt
skuggområde utgörs av sådana situationer där förvaltningsmyndigheten inte har fattat ett
bindande förvaltningsbeslut. Enligt kommitténs uppfattning är förfarandet för
förvaltningstvistemål enligt förvaltningsprocesslagen ett lämpligt sätt att trygga rättsskydden vid olika rättstvister inom förvaltningen, t.ex. rättstvister inom förvaltningen som erbjuder tjänster. Det är dock skäl att göra vissa preciseringar i bestämmelserna om tillämpningsområdet för förvaltningstvistemål i 69 § förvaltningsprocesslagen. På detta sätt skulle det vara lättare att få information om möjligheterna att tillämpa förfarandet för förvaltningstvistemål. Dessutom bör det övervägas huruvida det skall vara möjligt att som förvaltningstvistemål anhängiggöra en ansökning i vilken den sökande kräver att hans eller hennes rättigheter tillgodoses i ett sådant fall att förvaltningsmyndigheten dröjer med att fatta beslut eller inte alls fattar beslut i ärendet. Rättsskyddet inom den offentliga förvaltningen kan främjas genom att effektivt utnyttja offentliga samfunds ersättningsansvar. I kommitténs diskussioner har man tagit upp frågan om det skulle vara ändamålsenligt att överflytta behandlingen av dessa ersättningstvister från allmänna domstolar till förvaltningsdomstolarna. Detta är en övergripande fråga och det nuvarande förfarandet är för många delar motiverat, men kommittén anser ändå att det finns tunga skäl att påbörja en utredning för att ändra det nuvarande förfarandet. Frågan bör utredas vidare då ersättningsansvaret för offentliga samfund bedöms i samband med revideringen av skadeståndslagen. 3) Inskrivningsärenden gällande fastigheter. Behandlingen av inskrivningsärenden gällande fastigheter bör flyttas från tingsrätterna till förvaltningsmyndigheterna. Ett beslut som fattas vid inteckningsärenden är till sin rättsliga form nära ett administrativt tillståndsbeslut och rättsskyddet för innehavaren av rätten till fastigheten kan tryggas även genom ett dylikt förvaltningsbeslut. Kommittén har inte tagit ställning till vilken myndighet (t.ex. magistraten, lantmäteriförvaltningen) dessa inteckningsärenden borde flyttas utan detta skall avgöras när ärendet behandlas vidare. Att dessa uppgifter flyttas till en annan myndighet skulle göra tingsrätternas uppgiftsbeskrivning klarare och ge dem bättre möjligheter att koncentrera sig på sin kärnuppgift. 4) Ärenden gällande indrivning av ostridiga fordringar. Kommitténs majoritet anser att ärenden som gäller ostridiga fordringar (summariska ärenden) bör flyttas från tingsrätten till utsökningsväsendet. Vid ostridiga fordringar är det frågan om indrivning av fordringar och ärenden av denna natur hör till utsökningsväsendet. Betalningsskyldigheten är vanligtvis obestridlig och parternas rättsskydd kan tryggas även av utsökningsväsendet. Att dessa ärenden flyttas från tingsrätten förbättrar parternas rättsskydd, eftersom kostnaderna för indrivningen minskar och indrivningsprocessen blir snabbare. Detta skulle också göra tingsrätternas uppgiftsbeskrivning klarare och ge dem bättre möjligheter att koncentrera sig på sin kärnuppgift. Kommitténs minoritet (en medlem) anser att det inte är motiverat att flytta dessa ärenden från tingsrätten. 5) Vissa andra ärendegrupper. Kommittén anser att det skall strävas till att tingsrätterna i likhet med andra domstolar koncentrerar sig på att lösa rättstvister och konflikter som hör till deras kärnområde. När det i samband med beredning av materiell lagstiftning bedöms var nya ärendegrupper borde behandlas skall det utgås från att tingsrätten enbart behandlar sådana ärenden som hör under dess grundläggande uppgifter som en dömande myndighet. Också uppgifter som gäller följande ärendegrupper bör i mån av möjlighet behandlas av andra myndigheter än tingsrätten: dödförklaring, dödande av urkund, emottagande av ed och försäkran, uppgifter som har att göra med offentliga köpvittnen och bouppteckningar samt på lång sikt uppgifter som hänför sig till offentliga stämningar.
Kommittén föreslår att det utreds om det skulle vara möjligt att avstå från att tingsrätterna
förrättar borgerliga vigslar och registrerar partnerskap och att dessa uppgifter överförs till
magistraterna. När den materiella lagstiftningen i fråga om insolvensärenden revideras är
det skäl att utreda vad som skulle vara den mest ändamålsenliga arbetsfördelningen
mellan domstolarna och andra instanser när det gäller konkursärenden och ärenden som
hänför sig till skuldsanering för privatpersoner och företagssanering. Det skall utgås från
att dessa behandlas vid domstolarna enbart om de är stridiga eller om parternas rättskydd
av någon anledning kräver detta.
Rättegångsförfarandena (VI)

Rättegångsförfarandena moderniserades nästan i sin helhet under 1990-talet i samband
med reformen av civil- och straffprocessen, hovrättsprocessen samt
förvaltningsprocessen. Dessa bestämmelser har också efter reformen kunnat revideras och
ändras på ett effektivt sätt. De nya ändringarna till civilprocessen trädde i kraft i början av
år 2003 och de senaste ändringarna till hovrättsprocessen fr.o.m. den 1 oktober 2003. Nya
bestämmelser om både civil- och straffprocessen trädde i kraft den 1 oktober 2003. För
närvarande håller man på att revidera straffprocessen och ändringssökande hos högsta
domstolen samt extraordinärt ändringssökande. Nyligen har även förslag om delvis
revidering av systemet för ändringssökande i förvaltningslagskipningsärenden lagts fram.
Dessutom pågår lagberedningsarbetet för att precisera vissa detaljer inom processerna.
För närvarande finns det inget större behov att förnya rättegångsförfarandena.
Rättegångsförfarandena bör emellertid utvecklas ständigt. Rättegångsförfarandets
ändamålsenlighet är på många sätt bundet till dagens fenomen (t.ex. antalet och typen av
brottslighet samt den tekniska utvecklingen). Även samhälleliga omständigheter, den
internationella utvecklingen och Europas integration påverkar utvecklingen av
rättegångsförfarandena. Kommittén har i stället för att betrakta rättegångsförfarandena i
detalj tagit upp vissa synpunkter och tyngdpunktsområden som bör beaktas vid
utvecklingen av förfarandena.
Kommitténs ställningstaganden

1) Förstärkande av tingsrätternas sammansättningar. Tonvikten i lagskipningen vid
allmänna domstolar bör tydligare än för närvarande ligga på tingsrätterna. Detta
förutsätter att parternas rättsskydd vid tingsrättsprocessen förbättras. För att åstadkomma
detta är det centralt och nödvändigt att förstärka tingsrättens sammansättning i svåra,
omfattande och komplicerade brott- och tvistemål genom att sammansättningen i dessa
ärenden består av fler fackdomare än tidigare. En kollegial sammansättning är motiverad
även med tanke på utvecklandet av domarnas yrkesskicklighet och kunnande.
2) Flexiblare sammansättningar vid förvaltningsdomstolarna. I fråga om
förvaltningsdomstolarna bör det i lag med hänsyn till rättsskyddsaspekterna fastställas
vilka ärendegrupper som kunde handläggas i en inskränkt sammansättning med färre än
tre medlemmar. Vid bedömningen av tillämpningsområdet för en inskränkt
sammansättning skall förvaltningsdomstolens ställning som fullföljdsdomstol beaktas.
När det gäller högsta förvaltningsdomstolen skall det övervägas om behandling av
ärenden i en sammansättning med tre medlemmar kunde tillämpas allmänt på sådana ärenden i vilka det inte ges ett avgörande i en sakfråga. 3) Utveckling av nämndemannasystemet. Det är skäl att bevara nämndemannasystemet. Nämndemannasystemets tillämpningsområde i fråga om brottmål bör emellertid inskränkas. Målet skall vara att nämndemän deltar i behandlingen av grova brott. Ärenden som skall handläggas i en nämndemannasammansättning bör anges i lag. Kommittén har diskuterat om det finns skäl att tillämpa nämndemannasystemet även vid hovrätterna och förvaltningsdomstolarna. Kommitténs majoritet (åtta medlemmar) anser att det inte är motiverat att utvidga nämndemannasystemets tillämpningsområde till att omfatta hovrätterna och förvaltningsdomstolarna. Kommitténs minoritet (tre medlemmar) anser att nämndemannasystemet bör tillämpas även vid hovrätterna och förvaltningsdomstolarna. Två medlemmar i kommittén har inte tagit ställning till frågan. För närvarande väljs nämndemännen av kommunalfulmäktige. Kommittén anser att detta sätt att välja nämndemän är i viss mån problematisk med tanke på domstolarnas oberoende. Genom att valförfarandet ändras skulle man för denna del kunna öka förtroendet för nämndemannasystemet. Kommitténs majoritet (elva medlemmar) anser att sättet att välja nämndemän bör omvärderas i sin helhet. Det skall strävas till att skapa ett system där nämndemännen så mångsidigt som möjligt representerar befolkningen och att domstolarna i någon form deltar i valet. Kommitténs minoritet (två medlemmar) anser att det räcker med att valförfarandet utvecklas. Kommitténs majoritet (åtta medlemmar) anser att det bör avstås från att nämndemännen har individuell rösträtt och övergå till ett system där nämndemännen har en gemensam (kollektiv) rösträtt. Kommitténs minoritet (fem medlemmar) anser att den individuella rösträtten skall bevaras. 4) Ökande av allmänhetens förtroende för rättvist förfarande. I utvecklingen av rättegångsförfarandena bör vid sidan av de traditionella kvalitetskraven, dvs. säkerhet, snabb arbetstakt och förmånlighet, allt mer uppmärksamhet fästas vid att allmänheten upplever rättegångsförfarandet som rättvist. Frågor som är centrala i detta avseende är parternas möjligheter att delta i processen och hur de bemöts vid rättegången, växelverkan under processen, domarnas opartiskhet och yrkesetik samt motiveringarnas begriplighet. I utvecklandet av processens rättvisa är det frågan om att beakta individens och partens synvinkel vid rättegången. En logisk följd av detta är att parternas förväntningar på behandlingen av ärendet skall mer än förut beaktas av domstolarna och vid rättegångarna. 5) Tryggande av snabb arbetstakt vid rättegångarna. Kommittén anser att resursfördelningen inom domstolarna bör utvecklas i en flexiblare riktning för att trygga snabb arbetstakt vid rättegångarna. I detta syfte bör det utredas om det finns möjligheter att utvidga tingsdomarnas befogenhet så att den omfattar mer än tingsrättens domkrets och om en överbelastad domstol kunde överföra ärenden till en domstol med mindre arbetsbelastning. I fråga om tvistemål finns det för närvarande bestämmelser om tidsfristerna för behandlingen och tillkännagivande av de olika faserna i handläggningen. Motsvarande bestämmelser skall utvidgas till att omfatta alla domstolar och alla typer av ärenden. Också parternas rättsskyddsmedel i sådana situationer att ärendets behandling fördröjs bör förbättras. 6) Smidigare och enklare rättegångsförfaranden. Kommitténs majoritet (nio medlemmar) anser att rättegångsförfarandena bör utvecklas i en smidigare riktning och att domstolarna och parterna skall ges större valfrihet och bättre möjligheter att påverka processen. Målet skall vara att rättegångsförfarandet utvecklas så att den blir enklare för dem som deltar i processen. Kommitténs minoritet (fyra medlemmar) anser att tvistprocessen vid tingsrätterna inte genom lagstiftning behöver göras smidigare, eftersom förfarandet redan i dagens läge är tillräckligt flexibelt. Det är viktigt att fortgående följa ny teknologi och till exempel genom olika försöksprojekt testa dess lämplighet för rättegångar. För denna uppgift bör det inrättas ett bestående organ. Domstolarnas möjligheter att genom enkla förfaranden handlägga uppenbart ogrundade yrkanden bör utvecklas. 7) Förenklat förfarande för tvistemål och rättegångskostnaderna. Enligt kommitténs uppfattning finns det för närvarande inget behov att införa ett nytt förenklat förfarande för tvistemål i Finland. Däremot anser kommittén att för sänka tröskeln för att inleda rättegång bör det så snart som möjligt upprättas en tabell över rättegångskostnaderna eller ett tak för rättegångskostnaderna i fråga om mindre tvistemål. 8) Ökande av öppenhet vid rättegång. Rättegångars öppenhet bör ökas. För att uppnå detta mål bör lagstiftningen om offentlighet vid rättegång förnyas, den interna öppenheten vid rättegångsförfarandet utvecklas och kvaliteten på motiveringarna förbättras. Målen för det pågående lagberedningsarbetet angående offentlighet vid rättegång förtjänar att stödas. Öppenhet och offentlighet vid rättegång bör ökas och lagskipningens transparens förbättras vid alla domstolar. Mediernas möjligheter att öka den faktiska offentligheten vid rättegångar bör främjas och bestämmelserna om offentlighet vid rättegång bör klargöras. När frågan bereds vidare bör det i synnerhet sörjas för att offentlighet vid rättegång genomförs i tillräcklig mån även i fråga om skriftliga processer och att det inte i onödan ges olika bestämmelser om offentlighet vid rättegång för olika rättsskipningslinjer. Parternas rätt att bli hörda vid rättegång skall utvecklas och främjas i synnerhet genom s.k. informativ processledning (diskussion om rättsliga frågor, bestämmelser som tillämpas på tjänstens vägnar). Även i fråga om en rättslig fråga får domstolens avgörande inte komma som en överraskning till parterna. Informativ processledning skall i större omfattning tillämpas också på skriftliga processer. Förbättrandet av kvaliteten på motiveringarna är ett viktigt tyngdpunktsområde för utvecklingen. Utvecklandet skall främst ske genom utbildning med betoning på domarens yrkesetik och ansvar. Vid utnämning av domare bör det mer än förut fästas uppmärksamhet vid sökandenas yrkesskicklighet och i synnerhet sökandenas förmåga att motivera. Dessutom skall sökandenas skriftliga färdigheter och förmåga att motivera utredas mer systematiskt än för närvarande vid utnämning av domare. 9) Muntliga förhandlingar vid högsta domstolarna. Kommittén föreslår att förfarandet vid högsta domstolen och högsta förvaltningsdomstolen utvecklas genom att införa korta muntliga förhandlingar för att diskutera den rättsliga frågan (s.k. plädering av prejudikat). Detta förfarande skulle öka växelverkan mellan parterna och domstolen, vilket för sin del skulle främja en rättvis process. Detta skulle ge domstolsväsendet en större synlighet och göra de högsta domstolarna mer öppna för allmänheten. Dessutom kunde detta ha
utbildningsmässig betydelse. Förfarandet skulle också ge möjlighet att utveckla
arbetsfördelningen mellan rättegångsbiträdena och föredragandena (biträdande jurister) i
prejudikatsfrågor.
10) Införande av grupptalan. Kommittén föreslår att s.k. grupptalan för handläggning av
kollektiva mål tas upp för behandling på nytt eller att möjligheterna för andra särskilda
förfaranden utreds. På detta sätt kunde tillgången till rättsskydd tryggas även i sådana fall
där den skada som en enskild person har lidit är så liten att förrättande av en enskild
rättegång inte ekonomiskt sett skulle vara förnuftigt.
11) Systematisering av processbestämmelserna. De många delvisa reformer av
rättegångsförfarandena har lett till att rättegångsbalken till sin struktur är
osammanhängande och invecklad. Dessutom är bestämmelserna om behandling av
brottmål och förvaltningslagskipningsärenden i huvudsak utbredda i ett flertal särskilda
lagar, vilket kan göra det svårt att få en helhetsbild om domstolsförfarandena. Kommittén
anser att efter dessa talrika förnyelser bör arbetet för att systematisera och klargöra
bestämmelserna om rättegångsförfarandena påbörjas så snart som möjligt.

I samband med vidare utredning bör det övervägas om det finns skäl att de egentliga
förfarandebestämmelserna samlas i en särskild domstolslag (administrativa bestämmelser,
organisation, utnämning av domare och jäv samt grunderna för fördelning av ärendena).
Angående de olika särskilda lagarna med bestämmelser om rättegångsförfaranden bör det
övervägas om det är praktiskt att ha dessa skilda lagar eller om dessa bestämmelser kunde
intas i rättegångsbalken eller i den föreslagna särskilda domstolslagen. Dessutom bör det
övervägas om lagen borde innehålla principiella bestämmelser om målen för och
kvalitetskraven på en rättegångsprocess.
12) Rättegångens parter vid förvaltningslagskipning. Kommittén anser att även om det i
fråga om förvaltningslagskipningen inte finns anledning att övergå till ett allmänt
tvåpartsförhållande bör den processuella ställningen av i synnerhet en
förvaltningsmyndighet som fattat ett förvaltningsbeslut klargöras. Genom detta skall det
strävas till att faktorerna som påverkar rättegångens objektivitet är synligare än förut.
Angående myndighetens besvärsrätt anser kommittén att inom förvaltningslagskipningen
bör besvärsrätten av en representant för den offentliga förvaltningen utvidgas i sådana fall
att lagskipningsmyndigheten i första instans har ändrat förvaltningsbeslutet. Besvärsrätten
behöver emellertid inte vara allmängiltig, utan det kan ställas begränsningar för rätten att
anföra besvär eller det kan föreskrivas skilt om besvärsrätten i olika ärendegrupper, dock
med hänsyn till kraven på enhetlighet och den privata aktörens intressen.
13) Muntlig förhandling och synförrättning vid förvaltningslagskipning. Antalet muntliga
förhandlingar vid förvaltningsdomstolarna har ökat men förrättas fortfarande rätt så
sällan. Muntliga förhandlingar och synförrättningar har ofta betydelse vid utredningen av
ett ärende. Dessutom kan muntliga förhandlingar och synförrättningar för sin del påverka
hur parterna upplever rättegångsförfarandet. Trenden för utvecklingen bör vara att i
synnerhet muntliga förhandlingar förrättas vid förvaltningsdomstolarna oftare än för
närvarande. Muntliga förhandlingar har en central roll också i rättegångar vid
försäkringsdomstolen och marknadsdomstolen. Muntliga förhandlingar och
synförrättningar kan och behöver inte ha en lika stor betydelse vid högsta
förvaltningsdomstolen som de har i lägre instanser. Högsta förvaltningsdomstolen skall
dock vara beredd att vid behov förrätta en muntlig förhandling eller en syn. Detta kan
ibland vara nyttigt även om det bara skulle vara frågan om en rättslig fråga och inte
bedömning av faktum (se punkt 9 ovan).
14) Säkerhetsåtgärder. För att trygga tillräcklig tillgång till rättskydd skall
förvaltningsdomstolarna ha mer omfattande möjligheter än för närvarande att utnyttja
olika säkerhetsåtgärder.
Biträden vid rättegångar (VII)
Ett av kommitténs teman har varit advokatväsendet och offentlig rättshjälp som en del av
rättsskyddssystemet. Kommittén har begränsat detta tema till sådana frågor som har
direkta verkningar på domstolsväsendets verksamhet och utveckling. Ur kommitténs
synvinkel har den centrala frågan varit på vilket sätt rättegångsombudens och –biträdenas
yrkesskicklighet och kunnande kan tryggas.
Behovet av att anlita rättsliga experttjänster vid rättegångar har ökat i likhet med kraven
experttjänsternas kvalitet. Anlitandet av sakkunniga biträden har många positiva
verkningar. På detta sätt kan tillgodoseendet av parternas rättigheter och tillgången till
rättstjänster tryggas och detta kan även bidra till att göra domstolens verksamhet
smidigare och mer effektiv. Att rättegångsbiträden deltar i processer ger bättre
möjligheter att utveckla rättegången så att den blir mer flexibel och på ett bättre sätt
beaktar ärendets särdrag.
Med tanke på rättsskyddet är det viktigt att de rättsliga experttjänster som anlitas är av
hög kvalitet och felfria. Till yrkesskickligheten hör både teoretisk och praktisk kompetens
och yrkesetik. I detta avseende finns det skillnader i rättegångsombudens och –biträdenas
yrkeskunnighet. Detta gäller även för advokater. Å andra sidan är principerna för god
advokatsed bindande enbart för medlemmar i advokatföreningen och offentliga
rättsbiträden, varvid en person som uteslutits ur advokatföreningen kan fungera som
rättegångsombud eller rättegångsbiträde. Det skulle emellertid vara viktigt att alla
rättegångsombuden följer likadana yrkesetiska regler och att det övervakas att dessa
regler följs. Kommittén har utrett möjligheterna att verkställa detta.
Kommitténs ställningstaganden
Kommittén anser att behörighetsvillkoren för rättegångsombuden och rättegångsbiträdena
bör skärpas. Målet för detta skall vara att en part enbart kan företrädas av ett yrkesmässigt
kompetent och yrkesetiskt klanderfritt rättegångsombud eller rättegångsbiträde.
Verksamheten skall övervakas av ett självständigt och oberoende tillsyns- eller
disciplinorgan. Detta skall i huvudsak också gälla för förvaltningslagskipningen.
Behovet av att använda rättegångsbiträden vid rättegångar har under de senaste årtiondena
ökat. Enligt kommitténs bedömning finns det för närvarandet inget större behov av att
göra användningen av biträden vid domstolarna obligatoriskt. Det bör dock utredas
huruvida domstolarna borde ges mer omfattande befogenheter än för närvarande att i
enskilda fall förordna ett rättegångsbiträde för en part.
Behörighetsvillkoren för rättegångsbiträdena och –ombuden bör skärpas så att det för
biträdena och ombuden vid allmänna domstolar förutsätts högre juridisk examen. Rätten
att fungera som rättegångsbiträde och –ombud på basis av t.ex. släktskap (JK 15:2,3) bör
slopas. Släktingar kunde emellertid delta i rättegången t.ex. som stödpersoner. När det
gäller förvaltningsdomstolarna finns det däremot inget skäl att ställa kravet på högre
juridisk examen som ett uteslutande behörighetsvillkor.
Det bör föreskrivas att det behövs tillstånd för att sköta uppdraget som rättegångsbiträde
och rättegångsombud. Biträdena och ombuden bör omfattas av likadana yrkesetiska
regler. Ytterliga bör det i anslutning till reglerna skapas ett övergripande utbildnings- och
övervakningssystem. Det skall avgöras skilt på vilket sätt tillståndssystemet kan tillämpas
på förvaltningsdomstolarna och om det inom dem finns ärendegrupper i fråga om vilka
tillståndskravet snarare är en nackdel än en fördel.
En förutsättning för beviljandet av tillståndet skulle vara en tillräckligt lång
arbetserfarenhet och avläggande av en särskild examen för rättegångsbiträden eller -
ombud. Det skall inte räcka med den nuvarande advokatexamen utan examen skall vara
avsedd att mäta sökandens färdigheter att klanderfritt utföra i synnerhet de uppgifter som
skötseln av domstolsärenden kräver. De som beviljas tillståndet åläggs att regelbundet
delta i vidareutbildning och skaffa ansvarsförsäkring. Rättegångsbiträdenas och –
ombudens verksamhet bör övervakas. Tillståndet skall vara så allmängiltig som möjligt,
varvid tillståndsinnehavarna kan fungera som rättegångsbiträden och –ombud vid alla
domstolar. De som beviljas tillståndet skall vara skyldiga att följa de allmänna yrkesetiska
reglerna för rättegångsbiträden. Att reglerna följs skall övervakas. Det bör skilt övervägas
om det skulle vara praktiskt att enbart bevilja tidsbundna tillstånd.
Av de modeller för tillståndssystem som behandlades av kommittén fick två modeller
mest understöd: modellen där det under Finlands Advokatförbund skapas ett
advokatmonopol och modellen där licenssystemet är oberoende av medlemskap i
Finlands Advokatförbund och där licensen beviljas av någon annan instans än
advokatförbundet. Kommittén har inte tagit ställning till vilkendera modell som skulle
vara bättre, eftersom advokatföreningen för närvarande genomgår stora förändringar.
Båda modellerna bör jämställas när tillståndssystemet utvecklas. Domstolarna bör också
ges mångsidigare medel för övervakning i enskilda fall och domstolarnas roll i
övervakningen av rättegångsbiträdenas och –ombudens verksamhet skall förstärkas.
Alternativ för konfliktlösning (VIII)
Alternativen för domstolsbehandlingen är i många avseenden viktiga för tillgodoseendet
av parternas rättigheter. Tröskeln för att utnyttja ett alternativt förfarande är ofta lägre än
att använda domstolarna och i vissa fall är rättegångsförfarandet inte heller ett realistiskt
alternativ på grund av att det kräver tid och föranleder kostnader. De alternativa
förfaranden fungerar dessutom som en slags filter, eftersom alla rättstvister på detta sätt
inte styrs till domstolarna. Det nuvarande domstolsväsendet skulle inte ens ha resurser att
handlägga alla konflikter. Ett fungerande domstolsväsende är emellertid en förutsättning
för att de alternativa förfaranden skall kunna utnyttjas, eftersom möjligheten att i sista
hand föra ärendet till domstolen för avgörande är viktig med tanke på hur parterna
förbinder sig till de avgöranden som gjorts enligt det alternativa förfarandet. Å andra
sidan är traditionella rättegångar och alternativa förfaranden inte motsatta till varandra
och de ersätter inte heller varandra. I det moderna differentierade samhället inom vilket det finns mycket varierande konflikter och rättstvister behövs det ett mångsidigt system för lösning av rättstvister och konflikter. I vårt samhälle som allt mer genomsyras av juridik framhävs också betydelsen av rättslig rådgivning. I kapitel VIII behandlas andra konfliktlösningsalternativ än dömande. De alternativa konfliktlösningsmetoderna är: rättslig rådgivning, förlikning utanför domstolarna (civilärenden), nämnder, allmän laglighetsövervakning och ombudssystem samt skiljemannaförfarandet. Nämnder av domstolskaraktär behandlas emellertid i samband med domstolsorganisationen (kapitel X). Konfliktlösningsalternativ i brottmål och konfliktlösningsalternativ i domstolarna behandlas skilt. Syftet med detta har varit att skapa en helhetsbild om de konfliktlösningssystem som kan fungera som alternativ för den traditionella domstolsverksamheten och som på ett betydligt sätt kan bidra till att trygga rättsskyddet och till att skapa ett fungerande domstolsväsende. Kommitténs ställningstaganden 1) Rättslig rådgivning. De rådgivningssystem som för närvarande utnyttjas skall förstärkas och deras ställning säkerställas. I fortsättningen bör det kartläggas hur täckande rådgivningstjänsterna är, eftersom otillräcklig rådgivning kan vara ett problem inom vissa områden. Rådgivningstjänsterna och hela detta konfliktlösningssystem är en mycket varierande och oöverskådlig helhet. Den som behöver information kan inte alltid veta vem han eller hon borde vända sig till med sitt rättsliga problem. Av denna anledning har kommittén redan i sitt mellanbetänkande föreslagit att en tjänst för handledning i valet av rättskyddsmedel borde inrättas i Finland. Tjänsten bör vara riksomfattande och vem som helst skall kunna vända sig till denna tjänst med sina rättsliga problem. Vid rådgivningen är det inte frågan om att lösa det rättsliga problemet utan denna tjänst är avsedd för att kartlägga de rättsskyddsmedel som kunde utnyttjas för problemet i fråga. Dessutom föreslår kommittén att det inleds ett långsiktigt projekt för att utreda om man i Finland kunde skapa ett bredbasigt riksomfattande tjänstnätverk som baserar sig på samarbete mellan olika myndigheter och som erbjuder rättslig rådgivning och handledning, dvs. rättstjänstcentraler. Dessa rättstjänstcentraler kunde erbjuda handledning även i valet mellan olika rättsskyddsmedel, varvid den ovan nämnda skilda rättsliga rådgivningen inte längre skulle behövas. 2) Förlikning utanför domstolarna. I framtiden kommer tillämpningsområdet för alternativa konsliktlösningssystem utanför domstolarna, såsom förlikning, att utvidgas och det blir en större variation i förfarandena. Att förlikning i allt högre grad utnyttjas vid konfliktlösning är en positiv utveckling. Utvecklingen får dock inte bero på domstolstjänsternas dåliga kvalitet eller på att tjänsturvalet är för snäv utan det skall sörjas för att domstolsväsendet är fungerande. 3) Nämnder. Olika nämnder som ger rekommendationer, utlåtanden, anvisningar och rekommendationer för avgörande har en viktig roll när det gäller främjandet av tillgången till rättstjänster och därför är det skäl att fästa särskild uppmärksamhet vid att säkerställa nämndernas verksamhetsförutsättningar. 4) Allmän laglighetsövervakning samt fullmäktige och ombud. En central del av Finlands rättsordning har traditionellt varit den tillsyn som utövas av allmänna laglighetsövervakare. Det skall även i fortsättningen sörjas för att allmänheten kan vända sig till laglighetsövervakarna med sina problem utan några formföreskrifter. Laglighetsövervakarnas verksamhet är viktigt också med tanke på utvecklingen av myndigheternas verksamhet. Dessutom har verksamheten av de särskilda fullmäktige på olika områden en stor betydelse. 5) Skiljemannaförfarandet. Skiljemannaförfarandet är ett praktiskt sätt att lösa tvister i synnerhet inom näringslivet. Kommittén anser dock att ökningen i utnyttjandet av skiljemannaförfarandet i tvistemål inte får bero på att man upplever att domstolsförfarandet är för långsamt och att det inte finns tillräcklig sakkunskap inom domstolarna. Med tanke på domstolarnas samhälleliga ställning och för att framhäva den materiella lagstiftningen i samhället samt för att utveckla rättstjänsterna är det viktigt att domstolarna behandlar och avgör mycket varierande tvister som uppstår inom olika samhällssektorer. Av denna anledning bör domstolarnas förfaranden och verksamhet utvecklas så att de även i framtiden kan konkurrera med skiljemannaförfarandet. 6) Avgörande av brottmål utanför domstolarna. Förlikning är på grund av sina fördelar ett bra sätt att handlägga brottmål i synnerhet när det gäller smärre brottmål och till exempel brott som begås av de unga. När brottmål styrs till förlikning skall grunden för detta främst vara någon annan än rationalisering eller effektivisering av domstolarnas och åklagarens verksamhet. Om jämlik tillgång till förlikning i brottmål i hela landet bör föreskrivas i lag. Kommittén förhåller sig negativ till att s.k. åtalsförhandling (plea bargaining) skulle införas i Finland. Värdesättningarna och det praktiska genomförandet av detta förfarande lämpar sig inte för det finska straffrättssystemet. Straffrättsliga rättegångar kan effektiviseras utan att förfaranden som till sin struktur liknar åtalsförhandling tas i bruk. 7) Förlikning i domstolarna. Kommittén anser att det är nödvändigt att advokater och övriga rättegångsbiträden på ett uttömmande sätt utreder möjligheterna för förlikning innan ett tvistemål anhängiggörs hos domstolen. För närvarande är utredningen av förlikningsmöjligheterna ofta bristfällig. Denna omständighet bör åtgärdas främst genom att framhäva advokaters skyldighet att följa de yrkesetiska regler som ställts för dem och eventuellt genom att skärpa reglerna gällande god advokatsed. Sekundärt kunde legislativa möjligheter övervägas. Obligatorisk förlikning behöver emellertid inte tas i bruk. Kommittén anser att det nuvarande förfarandet för förlikning i domstol har fungerat rätt så bra, men att det i alla fall bör utvecklas. Vidareutvecklingen av förlikningsförfarandet och att det samordnas med det traditionella rättegångsförfarandet skall vara en av de viktigaste tyngdpunktsområden i domstolsväsendet under de närmaste åren och årtionden. Helheten får dock inte bli så mångformig att den skulle skada förfarandenas fungerlighet eller göra systemet oöverskådligt. Arbetsgruppen som tillsattes av justitieministeriet på våren 2003 (förlikningsarbetsgruppen) har föreslagit införande av ett nytt från rättegångar avskilt förfarande för förlikning i domstol. Kommittén har inte tagit ställning till detaljerna i arbetsgruppens förslag men konstaterar att förslaget som helhet kan understödas och att det utgör ett bra grundlag för vidare beredning. Kommittén anser att det föreslagna
förfarandet för förlikning i domstol bör testas. Efter att förfarandet har testats kan det
övervägas om det över huvud taget är möjligt och på vilket sätt detta från rättegångar
avskilda förfarandet för förlikning i domstolar och det nuvarande förlikningsförfarandet
som anknutits till rättegångar kunde integreras med varandra på ett bättre sätt än vad som
föreslås i förslaget. Kommittén har behandlat det danska domsförslagssystemet men anser
inte att det finns behov att införa denna modell.
Att domstolen aktivt strävar till att åstadkomma förlikning bör inte begränsas enbart till
tvistemål där förlikning är tillåten (dispositiva saker). Möjligheterna för förlikning bör
utredas även i sådana tvistemål där förlikning med anledning av ärendets natur inte är
begreppsmässigt möglig (indispositiva saker). I praktiken kan parterna ha nått
samförstånd i ärendet eller så kan det vara möjligt att de når samförstånd om avgörandet.
Vid förvaltningsärenden kan förlikningsförfarandet tillämpas enbart i begränsad mån.
Genom ett gott förvaltningsförfarande och förvaltningsmyndighetens självrättelse kan
rättstvister dock förebyggas. I fråga om förvaltningsärenden bör det dessutom utföras en
grundläggande utredning om det finns behov och möjligheter att utveckla nya medel för
konfliktlösning, uppnående av samförstånd och förlikning inom ramen för kraven på
rättskydd inom förvaltningen samt förvaltningens allmänna rättsliga principer. Vid
förvaltningsdomstolarna kan man redan med stöd av de nuvarande bestämmelserna
förrätta muntliga förhandlingar för att klargöra och begränsa det stridiga ärendet.
I framtiden kommer förlikningsverksamheten att vara en central tjänsthelhet inom
domstolsväsendet och inte längre bara en biprodukt i det traditionella
domstolsförfarandet. Detta förutsätter att det mer än förut satsas på att utveckla domarnas
färdigheter i fråga om förlikningsverksamheten. För att förlikning i domstolarna kan
kunna genomföras på ett effektivt och professionellt sätt kan det vara skäl att en del av
domarna specialiserar sig på förlikning.
För närvarande finns det ett behov att utveckla förlikningsmetoderna och göra de praxis
som tillämpas vid förlikning i samband med rättegångar enhetligare. Detta bör emellertid
inte ske genom lagstiftning utan i första hand genom att domarna vidareutbildas i
förlikningsverksamhet och att det skapas normativa modeller och handböcker om
förlikning, dvs. genom att förlikningsverksamheten utvecklas med hjälp av praktiska
åtgärder. Bestämmelserna om förlikning bör dock också ses över.
Kunnande och yrkesskicklighet (IX)
Kvaliteten på domstolens verksamhet är i första hand beroende av domarnas och den
övriga personalens kunnande och yrkesskicklighet. Det finns många sätt att påverka
kunnandet och yrkesskickligheten, t.ex. genom behörighetsutbildning,
utnämningsförfarandet, vidareutbildning samt inlärning genom praktiskt arbete och
specialisering. För att kunnandet och yrkesskickligheten skall kunna förbättras maximalt
skall alla dessa delområden utvecklas.
I detta kapitel betraktas kunnandet och yrkesskickligheten av domstolarnas personal ur
ovan nämnda synvinklar. Betraktningen gäller i synnerhet domarna. Ytterligare behandlas
i detta kapitel systemet med föredraganden och domstolspraktiken, eftersom dessa är centrala frågor med tanke på framtida domare och hela domstolsväsendet. Behörighetsutbildningen, vidareutbildningen och utnämningssystemen för domarna bör med hänsyn till domstolarnas samhälleliga uppgift kunna producera domare som inom juristkåren har bästa möjliga kunnande och yrkeskicklighet när det gäller lösning av tvister och konflikter. Kommitténs ställningstaganden 1) Domarnas specialisering. Eftersom domstolarna har allt mångsidigare uppgifter och skötseln av dessa uppgifter förutsätter allt mer vidsträckta kunskaper i olika ärenden medan kraven på domstolarnas verksamhet samtidigt ökar finns det ett behov av domare som specialiserat sig på vissa områden. För att trygga tillräcklig specialisering och yrkesskicklighet bör domstolsenheterna vara tillräckligt stora. Specialiseringen skall dock ske på ett sådant sätt att domarna fortfarande har en helhetsbild om rättsordningen. Detta kan främjas t.ex. genom uppgiftsrotation. Inrättandet av tjänster för specialdomare och samverkan mellan domstolarna bör också övervägas. Djupgående och bestående specialisering kan också komma i fråga om särdragen hos en viss ärendegrupp kräver detta. 2) Kanslipersonalens kunnande och yrkesskicklighet. Satsningar på kanslipersonalens kunnande och yrkesskicklighet är en väsentlig del av utvecklingen av hela domstolsväsendet. Hög yrkesskicklighet inom kanslipersonalen ger bättre möjligheter att utveckla arbetsmetoderna och finna en ändamålsenlig arbetsfördelning mellan personalen som fått juridisk utbildning och personalen som fått annan utbildning och på sätt kan också verksamheten effektiviseras. Målet skall vara att till en domares uppgiftsbeskrivning utöver ledning av rättegångar, avgörande av ärenden och motivering hör så lite andra uppgifter som möjligt. 3) Slopande av systemet med föredragande. Kommittén anser att det i dagens lägen förutsättningar och skäl att slopa systemet med föredragande i samtliga domstolar. Systemen som utvecklas i stället för detta bör emellertid vara delvis olika i högsta domstolen och andra fullföljdsdomstolar. Kommittén har inte lagt fram några detaljerade förslag till modeller för detta nya system men ställer dock riktlinjer och mål för vidareutveckling av ärendet. I andra fullföljdsdomstolar än högsta domstolarna bör utöver domarna finnas biträdande jurister, dock ett färre antal än nuvarande föredraganden. Domaren skall svara för ärendets beredning, processledning och utarbetandet av utkastet till avgörande samt vid skriftliga processer redogöra för ärendet till kollegiet. De biträdande juristerna skall biträda domaren i de olika faserna i arbetet och beslutsfattandet men de skall inte delta i domstolens beslutsfattande på samma sätt som nuvarande föredraganden. I de högsta domstolarna skall ärendet beredas av en biträdande jurist och denne skall också utarbeta ett utkast till avgörande under den ansvariga domarens handledning. Nämnda domare skall redogöra för ärendet till de andra som deltar i beslutsfattandet. Den biträdande juristen skall inte ha en liknande formell ställning i beslutsfattandet som nuvarande föredraganden men han eller hon kunde delta i domarnas förhandlingar. På grund av de högsta domstolarnas natur kan antalet biträdande jurister inte vara färre än det nuvarande antalet föredragande. Tjänsterna bör vara tidsbundna. Till dessa tjänster skall rekryteras begåvade och framstående jurister från domstolarna och andra håll. 4) Juridisk examen. Behörighetsvillkoret för domare bör vara högre juridisk examen. Studierna som ingår i examen skall vara av minst samma nivå som i nuvarande examen. Studierna skall ge tillräckligt helhetsbild om innehållet i den hela rättsordningen. Också andra än juridiska färdigheter som behövs i skötseln av domaruppgiften bör skaffas under studierna. Dessutom bör möjligheten att anknyta en obligatorisk praktikperiod i studierna övervägas. 5) Utökande av den utbildande verkan av domstolspraktik. Kommittén anser att det utbildande verkan av domstolspraktik bör utökas. Praktikens innehåll kunde utvecklas så att den främst skulle intressera jurister som söker sig till en karriär inom rättsväsendet. Även andra jurister bör dock kunna utföra domstolspraktik. Dessutom bör systemet ändras så att praktiken kan utföras även vid förvaltningsdomstolarna. Möjligheterna att förlänga praktiktiden och slopa tingsfiskalstjänsterna bör utredas. Sättet att välja praktikanterna bör också utvecklas. 6) Kvalificeringssystem för domare. Man håller på att bereda ett kvalificeringssystem för domare (justitieministeriets arbetsgrupps betänkande 2002:6). Kommittén anser att det eventuella kvalificeringssystemet enbart skall vara en av flera möjligheter att skaffa domarkompetensen. Sammansättningen av utbildningsnämnden skall utöver juridiska experter även bestå av andra medlemmar. Utbildningen skall stöda utvecklandet av studerandens förmåga för självständigt tänkande. Problemet med kvalificeringssystemet är den faktiska makt som utbildningsnämnden skulle ha vid utnämning av domare jämfört med den nuvarande domarförslagsnämnden. Kommittén har diskuterat en alternativ linje för utveckling av kvalificeringssystemet. Kommittén anser att det är viktigt att domare mer än förut utnämns även bland sådana jurister som inte från förut arbetar vid domstolarna (s.k. öppen karriär). Dessa kan naturligtvis behöva vidareutbildning när de övergår till att arbeta för domstolsväsendet. Däremot kan det att kvalificeringssystemet riktas till vissa utvalda jurister som är i början av sin karriär i praktiken leda till att möjligheten att gå in på en domarkarriär fortfarande är mycket begränsad. Kommittén anser att utvecklingen skall inledas med att den utbildande verkan av domstolspraktik utökas så att redan denna kan ge goda förutsättningar för en domarkarriär. Dessutom skall det satsas på att de som utnämns till domare vidareutbildas utgående från deras individuella behov. Med tanke på domstolsväsendet framtida behov skulle ett system där domarkompetensen skaffas genom den förnyade domstolspraktiken, kompletterande utbildning under juristkarriären och mångsidig erfarenhet vara bättre än det föreslagna kvalificeringssystemet. Att genomföra kvalificeringssystemet för domare (2002:6) är inte ändamålsenligt. 7) Vidareutbildning av domare och biträdande jurister. Att det satsas på en omfattande och effektiv vidareutbildning är viktigt för utvecklandet av hela domstolsväsendet verksamhet. Arbetsgivaren bör stöda domarnas möjligheter att delta i vidareutbildning. För domarna är utbildningen en del av skötseln av tjänsteuppdraget (tjänsteplikt). 8) Inlärning genom praktiskt arbete och utveckling av arbetsgemenskaperna. Det strävas till att yrkesskickligheten och kunnandet utvecklas på många olika sätt och en av dessa sätten är inlärning genom praktiskt arbete. Inlärning genom praktiskt arbete skall stödas t.ex. genom uppgiftsrotation och tjänstemannautbyte. Inlärning genom praktiskt arbete
kan ökas även genom att utöka kollegialiteten inom tingsrätterna.
Tyngdpunkten i utvecklingen av domstolarna skall allt tydligare vara på
domstolsenheterna och den lokala utvecklingen inom dem skall stödas. Detta förutsätter
en ny strukturering av utvecklingsarbetet inom domstolarna. Effektiv spridning av det
lokala utvecklingsarbetet förutsätter en centralförvaltning, ett domstolsnätverk och stöd
från de viktigaste samarbetsparterna. Gemensamma utvecklingsprojekt mellan domarna,
advokaterna och åklagarna och samarbetsprojekt mellan flera domstolar är exempel på
sådan nätverksbildning som förutsätts för effektiv utveckling av domstolarna.
9) Mångsidigare arbetserfarenhet för domare. En av de centrala målen för utvecklandet
av domstolsväsendet skall vara att de som utnämns till domare har en mångsidig
arbetserfarenhet och att till domare även utnämns personer som inte arbetar vid
domstolsväsendet. Mångsidig arbetserfarenhet är en positiv sak med tanke på domarnas
yrkesskicklighet samt domstolarnas kompetens och öppenhet. Genom att göra
domarkarriären öppnare kan man svara på de krav som det pluralistiska samhället ställer.
Kommittén har övervägt två alternativ för att göra domarkårens arbetsmässiga bakgrund
mångsidigare. För det första skall förfarandet vid val av domare utvecklas så att
möjligheten att inleda domarkarriär blir öppnare och för att de som utnämns till domare är
de mest skickliga och begåvade bland sökandena. Domaruppgiften skall utvecklas så att
den blir mer attraktiv. Även domarförslagsnämndens verksamhet skall utvecklas så att
den bättre än för närvarande kan bedöma sökandenas kompetens och lämplighet och att
tjänsteåldern inte är den tyngsta skälen vid utnämning av domare. Av denna anledning
skall det övervägas om det borde ordnas lämplighetsprövningar eller om
domarförslagsnämnden borde intervjua sökandena. Dessutom bör utlåtandena som
domstolarna ger om sökandena utvecklas.
Vidareutveckling av det nuvarande systemet är kanske inte det bästa sättet att öppna
möjligheten att inleda domarkarriär till jurister utanför domstolen. Av denna anledning
anser kommitténs majoritet (elva medlemmar) att det på kort sikt kan vara skäl att en del
av domartjänsterna som blir vakanta öronmärks för jurister som inte arbetar inom
domstolsväsendet (kvotsystem). I utvecklandet av modellen skall bestämmelsen om
utnämningsgrunder 125 § grundlagen och principen om icke-diskriminering iakttas.
Kommittén minoritet (två medlemmar) anser att kvotsystemet inte kan genomföras.
Domstolsorganisationen (X)
Utvecklingen av domstolsorganisationen skall betraktas främst i förhållande till vilka
uppgifter som hör till domstolen. Förenklat kan det sägas att domstolarnas basuppgift är
att lösa samhällets svåraste rättsliga konflikter som i fråga om medborgarnas rättsskydd
kan anses vara mest betydliga, även om domstolarna också i fortsättningen också avgör
relativt enkla och mindre ärenden. Domstolsväsendets organisation och omständigheter
som ligger nära det, såsom förvaltningen, skall struktureras på ett sådant sätt att de så väl
som möjligt stöder utförandet av domstolarnas basuppgifter.
I detta kapitel framförs en översikt över domstolarna och domstolsliknande
besvärsnämnder. I fråga om allmänna domstolar och allmänna förvaltningsdomstolar
behandlas de specialsammansättningar som finns i dem för närvarande. Dessutom presenteras de ärendegrupper som koncentrerats på en eller några domstolar. I detta kapitel behandlas också på en allmän nivå specialdomstolarna och deras intressegrupper samt i någon mån deras befogenheter. Efter detta behandlas utvecklingen av tingsrättsorganisationen och ändringssökande i tingsrättens beslut hos hovrätten. Slutligen behandlas vissa frågor som hänför sig till organisationen av förvaltningsdomstolarna. Enligt kommitténs uppdrag har arbetet utgått från principerna i den nya grundlagen och grundrättslighetsperspektiven. Kommittén har avstått från att behandla sådana frågor i anslutning till domstolväsendets grundläggande struktur som lösts i grundlagen av år 2000. Kommittén ställningstaganden 1) Specialdomstolarna. Kommittén ser inget behov att inrätta ytterligare specialdomstolar. Enligt kommitténs uppfattning bör man förhålla sig återhållsamt även till att befogenheterna av de nuvarande specialdomstolarna utvidgas genom att överföra ärenden från allmänna domstolar eller allmänna förvaltningsdomstolar till dem. Också i fråga om nya ärendegrupper bör det främst strävas till att dessa sköts av allmänna domstolar eller allmänna förvaltningsdomstolar. I den långsiktiga planeringen bör det utredas om försäkringsdomstolen och de ärenden som behandlas av den kunde integreras med domstolar som har ett mer allmänt verksamhetsområde. I försäkringsdomstolens sammansättningar finns sådana medlemmar som har uppgiften som bitjänst och vars medlemskap baserar sig på intressegruppernas förslag. Kommittén anser att detta arrangemang inte kan motiveras med behovet av särskild sakkunskap utan den behövliga sakkunskapen skall skaffas genom andra medel, t.ex. genom att utveckla bevisningen och att domarna specialiserar sig. Arrangemanget innebär också principiella problem som kan konkretiseras i avgörandena i enskilda fall. Sammansättningarna vid försäkringsdomstolen skall utvecklas så att det avstås från att använda medlemmar som har uppgiften som bitjänst och vars medlemskap baserar sig på intressegruppernas förslag. 2) Specialsammansättningar vid allmänna domstolar och allmänna förvaltningsdomstolar samt försäkringsdomstolens läkarmedlemmar. Eftersom samhället har blivit mer komplicerat och allt mer genomsyras av juridik krävs det också en allt högre sakkunskap av domstolarna. Kommittén anser att sakkunskapen och förfarandena inom allmänna domstolar och allmänna förvaltningsdomstolar bör allmänt taget utvecklas så att det i domstolarnas sammansättningar inte längre behövs sakkunniga medlemmar. Information som baserar sig på sakkunskap skulle i detta fall skaffas genom att höra sakkunniga vittnen och experter. Ett dylikt system lämpar sig emellertid inte av flera anledningar för alla ärendegrupper och därför kan användningen av sakkunniga medlemmar i vissa bestämda ärendegrupper vara motiverad. Kommittén anser att det bör utredas om domstolarna kunde få tillgång till den behövliga sakkunskapen genom något nytt förfarande. Vid omformningen av sakkunniga medlemmars deltagande skall kraven på rättegångens öppenhet tas beaktande. 3) Domstolsliknande besvärsnämnder. Utvecklingen som syftar till att förvaltningsrättsliga besvär i huvudregel skulle höra under förvaltningsdomstolarnas befogenhet bör fortsättas. Målet skall vara att det avstås från besvärsnämnder som utövar lagskipning. Den första fasen i fråga om förvaltningsrättsliga besvär kan och i många fall måste vara att ärendet tas upp i rättelseyrkandeförfarandet. Allmänna bestämmelser om vissa gemensamma frågor i anslutning till rättelseyrkanden, t.ex. ersättning för kostnader som föranleds av förfarandet, jävighet och muntligt hörande av parterna, bör intas i lag. 4) Tingsrätternas storlek och antalet tingsrätter. Arbetet för att öka storleken av tingsrätternas enheter och för att minska det totala antalet tingsrätter bör fortsättas och intensifieras. Tingsrätterna bör ha minst åtta till tio domare, helst något fler än detta. För att trygga den regionala tillgången till tingsrätternas tjänster är det dock sannolikt omöjligt att bilda så här stora tingsrätter i alla delar av landet. Antalet och placeringen av tingsrätterna preciseras under vidare beredning. Enligt kommitténs värdering skulle det räcka med 30 – 40 tingsrätter. Att tingsrättsenheterna blir större bidrar till att tyngdpunkten i lagskipningsarbetet inom allmänna domstolar är i tingsrätterna. När tingsrättsorganisationen utvecklas bör det tryggas att också den svenskspråkiga befolkningen har tillgång till tingsrätternas tjänster. 5) Hovrätternas ställning i rättsinstansordningen. Tyngdpunkten i lagskipningsarbetet inom allmänna domstolars verksamhetsområde bör vara i tingsrätterna. Hovrätternas huvudsakliga uppgift skall vara att kontrollera att tingsrätten inte har gjort ett felaktigt avgörande. För att uppnå detta mål har kommittén kommit med flera förslag till att förstärka tingsrätterna och för att förbättra rättsskyddet i tingsrättsförfarandet. Förstärkandet av tingsrätterna ger också möjlighet att omvärdera hovrätternas ställning och uppgifter i rättsinstansordningen. När det har säkerställts att tingsrätten som första rättsinstans på bästa möjliga sätt kan trygga att parternas rättsskydd tillgodoses, kan det på lång sikt övervägas om ändringssökande i tingsrättens avgörande på ett eller annat sätt kunde begränsas, t.ex. i bevisningsfrågor. 6) Systemet med allmänna förvaltningsdomstolar i två instanser. Förvaltningslag-skipningssystemet bygger på ett system med allmänna förvaltningsdomstolar i två instanser. Det finns dock flera undantag i fråga om detta. Dessa undantag bör fortfarande betydligt minskas. Tryggandet och förbättrandet av högsta förvaltningsdomstolens verksamhet förutsätter att högsta förvaltningsdomstolen i framtiden kan betydligt mer än för närvarande koncentrera sig på att handlägga svåra och med tanke på rättsskyddet betydliga ärenden. Ett centralt sätt att åstadkomma detta är att utvidga tillämpningsområdet för ett sådant besvärstillståndssystem, där beviljandet av besvärstillstånd inte begränsas av den s.k. prejudikatgrunden utan besvärstillstånd kan beviljas också på basen av uppenbara fel. När ändringssökandeförfarandet reformeras bör det utgås från att tillgodoseendet av rättsskyddet inte kan basera sig på en allmän organisatorisk helhetslösning utan att detta bedöms skilt för olika ärendegrupper. 7) Ändringssökande i ärenden som gäller social trygghet. Kommittén anser att det är viktigt att de förslag som kommittén för ändringssökande i ärenden som gäller social trygghet (KM 2001:9) har lagt fram genomförs så snart som möjligt. I lång sikt bör det emellertid bedömas på nytt om det finns ett behov att nämnderna för ändringssökande i ärenden som gäller social trygghet bevaras som lagskipningsorgan. Samtidigt bör det bedömas vad förhållandet mellan ändringssökandet i dessa ärenden och det allmänna förvaltningslagskipningssystemets är. Domstolarnas ledning (XI)

Domstolarnas ledning har en central roll när det gäller framgångsrik verksamhet vid
domstolarna. En god ledning skapar goda förutsättningar att handlägga och avgöra
ärenden så att kraven på rättssäkerhet uppfylls. De snabba förändringarna inom
verksamhetsområdet samt de allt högre kraven på kvalitet och effektivitet ställer
domstolarnas ledning inför nya krav. Det är därmed skäl att mer än förut framhäva vikten
av en god ledning.
Kommittén har tagit upp vissa centrala synpunkter angående domstolarnas ledning.
Resultatstyrningssystemet som domstolarna började tillämpa under 1990-talet kommer på
samma sätt som inom den övriga statsförvaltningen att utvecklas och fördjupas under de
närmaste åren. För att framhäva klienternas synvinkel förutsätts emellertid att
uppmärksamhet fästs utöver kvantitativa resultat även vid kvalitativa faktorer och resultat
(t.ex. kundtillfredsställelse under rättegångsprocessens olika faser). Domstolarna bör
pröva olika system för kvalitetsstyrning. Resultatstyrningen kommer i alla fall att
utvidgas och utvecklas utgående från principerna i kvalitetsstyrningssystemen. En dylik
utveckling är positiv. Ledningen bör dessutom utvecklas så att den allt mer baserar sig på
’coaching’ och diskussion. På detta sätt kan ledningen främja en öppen och jämlik
växelverkan med personalen, motivera och stöda personalen samt utveckla personalens
kunnande och yrkesskicklighet.
Domstolarna är enrådighetsverk och till sin struktur är detta ett fungerande styrnings- och
förvaltningssystem även i fortsättningen. Utmaningen ligger i utvecklandet av ledningens
innehåll. Kommittén har utrett domstolarnas verksamhet å ena sidan som administrativa
enheter och å andra sidan som lagskipningsenheter. Kommittén har dessutom diskuterat
ledningens innehåll och rekryteringen av domstolarnas chefer. Ytterligare har kommittén
behandlat frågor som gäller tillsynen över domarna.
Kommitténs ställningstaganden
Chefsdomaren har ett omfattande ansvar för effektiviteten och de ekonomiska och
samhälleliga effekter av domstolens verksamhet. Dessutom svarar han eller hon för att
personalens arbetsförmåga kan upprätthållas även om omständigheterna ändras och
kraven ökas samt att personalen upplever sitt arbete som meningsfullt och utmanande.
Det sistnämnda kräver att i synnerhet personalledningen utvecklas. Chefsdomaren bör
satsa på att verksamheten och särskilt lagskipningen i domstolen utvecklas. Eftersom
ledningen är en allt viktigare faktor för framgångsrik verksamhet skall domstolarna ha en
professionell ledning.
Domarnas oberoende hindrar i och för sig inte en effektiv ledning. Med hänsyn till
domarnas oberoende skulle det vara motiverat att i lagstiftningen inta mer detaljerade
bestämmelser om uppgifterna och befogenheterna av sådana domare som har
chefsuppgifter vid en domstol.
Utöver erfarenhet av domarvärv förutsätts av den som utses till tjänst som chefsdomare
även ledarförmåga. Utnämningen till en tjänst med chefsuppgifter kan inte enbart grunda
sig på en persons tjänsteår som domare. För att skapa en professionell ledning vid
domstolarna är det skäl att utreda möjligheterna att utbilda personer som är intresserade
av chefsuppgifter eller annars lämpliga för uppgiften redan i början av domarkarriären.
Domare med chefsuppgifter behöver fortgående och omfattande ledarutbildning. För
domstolarnas chefsdomare bör det inom domstolarnas centralförvaltning inrättas en enhet
för stöd och utveckling av ledningen.
Chefsdomarna har för närvarande ordinarie tjänst. Kommittén föreslår att det skall utredas
om uppgiften som chefsdomare och övriga ordinarie domartjänster till vilka hör att verka
som chef borde vara tidsbundna.
Kommittén föreslår att det inrättas en tillsynsnämnd för övervakning av domarnas
verksamhet. Tillsynsnämnden bör som disciplinär påföljd kunna ge kritik eller en varning
angående en domares verksamhet. Nämndens avgöranden skall kunna överklagas hos
domstolen. Nämnden skall även kunna avge utlåtanden om vad som förutsätts av god
domarsed. Klagan kan anföras av alla parter i en rättegång, chefsdomaren, Finlands
Advokatförbund, allmänna laglighetsövervakningsmyndigheter och representanter för
domstolsväsendets centralförvaltning. Tillsynsnämndens förfaranden bör utvecklas till
den riktningen att de allmänna laglighetsövervakarna kan överföra klagomål som gäller
domare till nämnden. Småningom kan det avstås från att de allmänna
laglighetsövervakarna utövar tillsyn över domarna. Tillsynsnämnden kunde även ha
möjlighet att anhängiggöra en brottsundersökning.

Domstolsväsendets centralförvaltning (XII)

Utvecklingsbehoven inom domstolsväsendet förutsätter att det bedöms hur väl dess
centralförvaltning fungerar och att centralförvaltningen förnyas och utvecklas. Inom
centralförvaltningen bör finnas en enhet med tillräckliga resurser för utveckling av
domstolsväsendets verksamhet, för forskning och för att erbjuda stöd för ledningen.
Representanter för domarkåren och den övriga personalen skall delta i det
utvecklingsarbete som koordineras av centralförvaltningen. Centralförvaltningen skall på
ett effektivt, pålitligt och professionellt sätt samt med beaktande av de olika domstolars
särdrag sörja för de administrativa uppgifter inom domstolsväsendet som hör till den. Vid
organiserandet av centralförvaltningen skall de allmänna trenderna för
centralförvaltningars utveckling och den internationella utvecklingen beaktas.
Centralförvaltningen skall skötas på ett sådant sätt att den är i harmoni med domstolarnas
oberoende.
I detta kapitel har frågor i anslutning till centralförvaltningen behandlats för det första i
ljuset av den tidigare debatten om detta tema. För det andra presenteras
centralförvaltningens nuläge och därefter behandlas högsta domstolarnas och hovrätternas
förvaltnings- och tillsynsuppgifter samt resultatstyrningssystemet. För det tredje redogörs
det för hur centralförvaltningen har ordnats inom justitieministeriets verksamhetsområde
och i organisationer som ligger nära domstolarna. Ytterligare behandlas moderna
riktlinjer för utvecklingen. Därefter behandlas centralförvaltningens framtida uppgifter,
den nuvarande centralförvaltningen som sköts av justitieministeriet och de faktorer som
påverkar utvecklingen. Till slut presenteras kommitténs tankar om riktlinjerna för
framtida utveckling.
Kommitténs ställningstaganden 1) Resultatstyrningssystemet. Resultatstyrningssystemet innehåller vissa problem med tanke på domstolarnas oberoende. Resultatstyrningssystemet avses att skärpas och det planeras att kvaliteten på och verkningarna av domstolarnas verksamhet skall mätas och värderas på ett mer djupgående sätt, vilket kan medföra ytterliga problem. Å andra sidan är det dock nödvändigt att utveckla ett system för resursfördelning och för mätning av kvalitet som bättre än det nuvarande systemet lämpar sig för domstolsväsendet. För att säkerställa domstolarnas oberoende bör domarna och domstolarna aktivt delta i utvecklandet av dessa system. 2) Högsta domstolarnas och hovrätternas roll i domstolsförvaltningen. Innehållet för den styrning som högsta domstolen och högsta förvaltningsdomstolen samt hovrätterna utövar på underställda domstolar och som sker på något annat sätt än genom avgöranden har inte preciserats. Innehållet för denna styrning bör klargöras. På grund av domstolarnas rättsinstansvisa oberoende är det svårt att utvidga den nuvarande styrningen. Å andra sidan skulle det vara en positiv utveckling om olika rättsinstanser och till och med olika lagskipningslinjer mer än för närvarande kunde samarbeta för att förbättra lagskipningsarbetets kvalitet. Samarbetet skall emellertid inte i första hand basera sig på domstolarnas formella hierarki utan de olika rättsinstanserna bör delta jämlikt i utvecklingsarbetet. Genom att utnyttja olika domstolars synpunkter och specialkunskaper kan det strävas till att finna det bästa tillvägagångssättet i enskilda fall samt att utveckla domarkårens kunnande, yrkesskicklighet och en gemensam domaridentitet. Det är skäl att omvärdera ändamålsenligheten av den kontroll som hovrätterna har över tingsrätterna och möjligheterna att avstå från kontrollverksamheten i sin nuvarande form. 3) Utveckling av centralförvaltningen. Kommitténs majoritet (sju medlemmar) anser att domstolsväsendets centralförvaltning bör förnyas och att den skall utvecklas utgående från en modell där förvaltningen sköts av en från justitieministeriet avskiljd centralförvaltningsenhet. En från justitieministeriet avskiljd centralförvaltningsenhet skulle i jämförelse med de andra modellerna ge bättre möjligheter att förstärka utvecklingen av domstolsväsendet och på ett effektivt sätt trygga att domstolarna har centralförvaltningens stöd i sitt utvecklingsarbete. Representanter för domstolarnas personal skall delta i domstolsväsendets utveckling och beslutsfattandet som rör domstolsväsendet. Denna modell är också till sin organisatoriska och administrativa struktur tydlig. Tillämpandet av denna modell skulle vara i analogi med de senaste riktlinjerna för utvecklingen i Finland och de förnyelser som under de senaste tiderna gjorts i centralförvaltningen i andra länder – i synnerhet i Norden. En från justitieministeriet avskild centralförvaltning skulle framhäva domstolarnas oberoende och även i övrigt klargöra domstolarnas ställning i samhället. Detta skulle vara en positiv utveckling med tanke på domstolarnas image och det allmänna förtroendet för domstolarnas verksamhet. Kommitténs minoritet (sex medlemmar) anser att de utgångspunkter för utvecklingen av domstolsväsendet som läggs fram i betänkandet inte förutsätter att det inrättas en särskild centralförvaltningsmyndighet. Det bör inrättas en särskild enhet för utveckling av domstolsväsendet vid justitieministeriet. Enheten skall ha i uppgift att utveckla metoder för att uppfölja kvaliteten på domstolarnas arbete och stöda domstolarnas eget utvecklingsarbete.

Source: http://www.xn--oikeusministeri-ntb.fi/text/fi/index/julkaisut/julkaisuarkisto/1146647391860/Files/ng1i75qhyqiu.pdf

Microsoft word - lpmwork.docx

Associate Researcher at the 'Laboratoire de Physique Moléculaire' (LPM) of Besançon (December 2002 - June 2005). During my stay at the LPM, I have contributed to develop the group of Biophysics which had beeninitiated by Prof. Christophe Ramseyer (physicist). The essential part of my work consisted in theoretical computational studies dealing with lipidicsystems and the membrane protein Kc

Microsoft word - ph d seminar handout.doc

EURAM-EDAMBA-EIASM DOCTORAL CONSORTIUM 2005 EURAM 2005 Pre-Conference Event Wednesday, May 4th 2005 (9:00 - 15:45 h) at the TUM Business School, City Campus, Munich, Germany, Room 1601 EURAM (European Academy of Management), EDAMBA (European Doctoral Programs Association in Management and Business Administration) and EIASM (European Institute for Advanced Studies in Management) invite

Copyright © 2010-2014 Medical Science